PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27981
Common NameKK1_028475
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 185aa    MW: 20904.7 Da    PI: 4.6934
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27981genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB111.83.8e-35189896
          NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                   +Pi+nv++i +++lP+nak+s+ ake++q+ ++++i+fvt +a ++cq e rk +n +d+lwa+ +lGf+dyv pl+++l++yr+++g+
  C.cajan_27981  1 MPITNVTKITRRILPNNAKLSDSAKEMIQQSATKYITFVTRKAKERCQSEYRKIMNVEDVLWAMEKLGFHDYVRPLNIFLQRYRDIDGA 89
                   8************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.26E-24187IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.9E-32187IPR009072Histone-fold
PfamPF008087.4E-16164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.8E-112846No hitNo description
PRINTSPR006159.8E-114765No hitNo description
PRINTSPR006159.8E-116684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MPITNVTKIT RRILPNNAKL SDSAKEMIQQ SATKYITFVT RKAKERCQSE YRKIMNVEDV  60
LWAMEKLGFH DYVRPLNIFL QRYRDIDGAD YFAHTVDPTP CTDNNNGPSF GVEPNLVPTM  120
EMLHAPLPPP VPSSGSNFSM DPNTNMEIFD PNDVNELYLE GLGVDCSDGA FTNFSPSALF  180
KYDQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-24185892Transcription factor HapC (Eurofung)
4g92_B2e-24185892Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628426.17e-74PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A151S4P31e-138A0A151S4P3_CAJCA; Nuclear transcription factor Y subunit B-6
STRINGGLYMA07G29695.12e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-35nuclear factor Y, subunit B6